Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SMUG1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about SMUG1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00023583-A01 |
| Product name: | SMUG1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SMUG1. |
| Gene id: | 23583 |
| Gene name: | SMUG1 |
| Gene alias: | FDG|HMUDG|MGC104370|UNG3 |
| Gene description: | single-strand-selective monofunctional uracil-DNA glycosylase 1 |
| Genbank accession: | NM_014311 |
| Immunogen: | SMUG1 (NP_055126, 2 a.a. ~ 78 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKE |
| Protein accession: | NP_055126 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.58 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SMUG1 polyclonal antibody (A01), Lot # 060608JCS1 Western Blot analysis of SMUG1 expression in SJCRH30 ( Cat # L027V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | URACIL-DNA glycosylase in base excision repair and adaptive immunity - species differences between man and mouse.Doseth B, Visnes T, Wallenius A, Ericsson I, Sarno A, Pettersen HS, Flatberg A, Catterall T, Slupphaug G, Krokan HE, Kavli B. J Biol Chem. 2011 Mar 23. [Epub ahead of print] |