Brand: | Abnova |
Reference: | H00023576-M01 |
Product name: | DDAH1 monoclonal antibody (M01), clone 3F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DDAH1. |
Clone: | 3F7 |
Isotype: | IgG2a Kappa |
Gene id: | 23576 |
Gene name: | DDAH1 |
Gene alias: | DDAH|FLJ21264|FLJ25539 |
Gene description: | dimethylarginine dimethylaminohydrolase 1 |
Genbank accession: | NM_012137 |
Immunogen: | DDAH1 (NP_036269.1, 181 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS |
Protein accession: | NP_036269.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DDAH1 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |