| Brand: | Abnova |
| Reference: | H00023563-M05 |
| Product name: | CHST5 monoclonal antibody (M05), clone 2E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CHST5. |
| Clone: | 2E6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 23563 |
| Gene name: | CHST5 |
| Gene alias: | FLJ22167|I-GlcNAc-6-ST|MGC74625 |
| Gene description: | carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5 |
| Genbank accession: | NM_012126 |
| Immunogen: | CHST5 (NP_036258.1, 310 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD |
| Protein accession: | NP_036258.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CHST5 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Galacto-oligosaccharides may directly enhance intestinal barrier function through the modulation of goblet cells.Bhatia S, Prabhu PN, Benefiel AC, Miller MJ, Chow J, Davis SR, Gaskins HR Mol Nutr Food Res. 2014 Nov 25. doi: 10.1002/mnfr.201400639. |