No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,IP |
| Brand: | Abnova |
| Reference: | H00023562-M01 |
| Product name: | CLDN14 monoclonal antibody (M01), clone 3D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CLDN14. |
| Clone: | 3D11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23562 |
| Gene name: | CLDN14 |
| Gene alias: | DFNB29 |
| Gene description: | claudin 14 |
| Genbank accession: | NM_012130 |
| Immunogen: | CLDN14 (NP_036262, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR |
| Protein accession: | NP_036262 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoprecipitation of CLDN14 transfected lysate using anti-CLDN14 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CLDN14 MaxPab rabbit polyclonal antibody. |
| Applications: | S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |