Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of WBP2 monoclonal antibody (M02), clone 3B1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr |
More info about WBP2 monoclonal antibody (M02), clone 3B1
| Brand: | Abnova |
| Reference: | H00023558-M02 |
| Product name: | WBP2 monoclonal antibody (M02), clone 3B1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant WBP2. |
| Clone: | 3B1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23558 |
| Gene name: | WBP2 |
| Gene alias: | MGC18269|WBP-2 |
| Gene description: | WW domain binding protein 2 |
| Genbank accession: | BC010616 |
| Immunogen: | WBP2 (AAH10616, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPSGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ |
| Protein accession: | AAH10616 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.45 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of WBP2 expression in transfected 293T cell line by WBP2 monoclonal antibody (M02), clone 3B1. Lane 1: WBP2 transfected lysate (Predicted MW: 28.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Tyrosine phosphorylation of transcriptional coactivator WW-domain binding protein 2 regulates estrogen receptor α function in breast cancer via the Wnt pathway.Lim SK, Orhant-Prioux M, Toy W, Tan KY, Lim YP. FASEB J. 2011 Sep;25(9):3004-18. Epub 2011 Jun 3. |