Login to display prices
Login to display prices
Mus musculus Leukocyte surface antigen CD47 recombinant protein View larger

Mus musculus Leukocyte surface antigen CD47 recombinant protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Mus musculus Leukocyte surface antigen CD47 recombinant protein

BrandProteoGenix
Product typeProteins
Origin speciesMouse
Host speciesMammalian

More info about Mus musculus Leukocyte surface antigen CD47 recombinant protein

Proteogenix reference: PX-P4009-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Mus musculus Leukocyte surface antigen CD47 recombinant protein
Fragment type: Partial
Expression system: Eukaryotic expression
Molecular weight with tag if any: 18.85kDa
Purity estimated: 80%
Uniprot id: Q61735
Uniprot link: http://www.uniprot.org/uniprot/Q61735
Aliases / synonyms: CD47, MER6, OA3, Antigen Identified By Monoclonal Antibody 1D8, Antigenic Surface Determinant Protein OA3, Rh-Related Antigen
Protein sequence (w/o tag): MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPNEKIGSHHHHHH
Form: Lyophilized
Buffer: 50mM Tris-HCl pH 7.0, 150mM NaCl
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: any condition
Delivery lead time in business days: 5-7

30 other products in the same category: