Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products
Total shipping To be determined
Total
Data sheet of Human Leukocyte surface antigen CD47 recombinant protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Mammalian |
More info about Human Leukocyte surface antigen CD47 recombinant protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P4008-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human Leukocyte surface antigen CD47 recombinant protein |
| Fragment type: | Partial |
| Origin species: | Human |
| Expression system: | Eukaryotic expression |
| Host species: | Mammalian |
| Molecular weight with tag if any: | 16.64kDa |
| Purity estimated: | 80% |
| Uniprot id: | Q08722 |
| Uniprot link: | http://www.uniprot.org/uniprot/Q08722 |
| Aliases / synonyms: | CD47, MER6, OA3, Antigen Identified By Monoclonal Antibody 1D8, Antigenic Surface Determinant Protein OA3, Rh-Related Antigen |
| Protein sequence (w/o tag): | MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGSHHHHHH |
| Form: | Lyophilized |
| Buffer: | 50mM Tris-HCl pH 7.0, 150mM NaCl |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | any condition |
| Delivery lead time in business days: | 5-7 |
| Related products: | - Mus musculus Leukocyte surface antigen CD47 recombinant protein - Human Alpha-fetoprotein/Beta-actin recombinant protein - Actin beta recombinant protein |