New product
Availability date:
Brand | ProteoGenix |
Product type | Proteins |
Origin species | Human |
Host species | Mammalian |
Brand: | ProteoGenix |
Proteogenix reference: | PX-P4008-10 |
Protein delivered with tag?: | Yes |
Size: | 10 ug |
Product name: | Human Leukocyte surface antigen CD47 recombinant protein |
Fragment type: | Partial |
Origin species: | Human |
Expression system: | Eukaryotic expression |
Host species: | Mammalian |
Molecular weight with tag if any: | 16.64kDa |
Purity estimated: | 80% |
Uniprot id: | Q08722 |
Uniprot link: | http://www.uniprot.org/uniprot/Q08722 |
Aliases / synonyms: | CD47, MER6, OA3, Antigen Identified By Monoclonal Antibody 1D8, Antigenic Surface Determinant Protein OA3, Rh-Related Antigen |
Protein sequence (w/o tag): | MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGSHHHHHH |
Form: | Lyophilized |
Buffer: | 50mM Tris-HCl pH 7.0, 150mM NaCl |
Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Delivery condition: | any condition |
Delivery lead time in business days: | 5-7 |
Related products: | - Mus musculus Leukocyte surface antigen CD47 recombinant protein - Human Alpha-fetoprotein/Beta-actin recombinant protein - Actin beta recombinant protein |