Login to display prices
Login to display prices
Human Protein S100 beta (S100B) recombinant protein View larger

Human Protein S100 beta (S100B) recombinant protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human Protein S100 beta (S100B) recombinant protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human Protein S100 beta (S100B) recombinant protein

Proteogenix reference: PX-P4007-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human Protein S100 beta (S100B) recombinant protein
Fragment type: Full-length
Expression system: Prokaryotic expression
Molecular weight with tag if any: 11.78kDa
Purity estimated: 90%
Uniprot id: P04271
Uniprot link: http://www.uniprot.org/uniprot/P04271
Aliases / synonyms: S100-B, NEF, S100Beta, S-100 protein subunit beta
Protein sequence (w/o tag): MGSHHHHHHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Form: Lyophilized
Buffer: PBS, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: any condition
Delivery lead time in business days: 5-7
Image: PX-P4007.jpg

30 other products in the same category: