Login to display prices
Login to display prices
Streptococcus pyogenes Endo-beta-N-acetylglucosaminidase F2 recombinant protein View larger

Streptococcus pyogenes Endo-beta-N-acetylglucosaminidase F2 recombinant protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Streptococcus pyogenes Endo-beta-N-acetylglucosaminidase F2 recombinant protein

BrandProteoGenix
Product typeProteins
Origin speciesStreptococcus pyogenes
Host speciesEscherichia coli (E. coli)

More info about Streptococcus pyogenes Endo-beta-N-acetylglucosaminidase F2 recombinant protein

Protein delivered with tag?: Yes
Size: 10 ug
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 109.1kDa
Purity estimated: 85%
Uniprot id: Q9APG4
Uniprot link: http://www.uniprot.org/uniprot/Q9APG4
Aliases / synonyms: EndoS, ndoS, Endo-beta-N-acetylglucosaminidase F2, Secreted endoglycosidase EndoS, Endo-beta-N-acetylglucosaminidase F2
Protein sequence (w/o tag): MGSHHHHHHSGEEKTVQVQKGLPSIDSLHYLSENSKKEFKEELSKAGQESQKVKEILAKAQQADKQAQELAKMKIPEKIP MKPLHGPLYGGYFRTWHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSLFWKELATKHVPKLNKQGTRVIRTIPW RFLAGGDNSGIAEDTSKYPNTPEGNKALAKAIVDEYVYKYNLDGLDVDVEHDSIPKVDKKEDTAGVERSIQVFEEIGKLI GPKGVDKSRLFIMDSTYMADKNPLIERGAPYINLLLVQVYGSQGEKGGWEPVSNRPEKTMEERWQGYSKYIRPEQYMIGF SFYEENAQEGNLWYDINSRKDEDKANGINTDITGTRAERYARWQPKTGGVKGGIFSYAIDRDGVAHQPKKYAKQKEFKDA TDNIFHSDYSVSKALKTVMLKDKSYDLIDEKDFPDKALREAVMAQVGTRKGDLERFNGTLRLDNPAIQSLEGLNKFKKLA QLDLIGLSRITKLDRSVLPANMKPGKDTLETVLETYKKDNKEEPATIPPVSLKVSGLTGLKELDLSGFDRETLAGLDAAT LTSLEKVDISGNKLDLAPGTENRQIFDTMLSTISNHVGSNEQTVKFDKQKPTGHYPDTYGKTSLRLPVANEKVDLQSQLL FGTVTNQGTLINSEADYKAYQNHKIAGRSFVDSNYHYNNFKVSYENYTVKVTDSTLGTTTDKTLATDKEETYKVDFFSPA DKTKAVHTAKVIVGDEKTMMVNLAEGATVIGGSADPVNARKVFDGQLGSETDNISLGWDSKQSIIFKLKEDGLIKHWRFF NDSARNPETTNKPIQEASLQIFNIKDYNLDNLLENPNKFDDEKYWITVDTYSAQGERATAFSNTLNNITSKYWRVVFDTK GDRYSSPVVPELQILGYPLPNADTIMKTVTTAKELSQQKDKFSQKMLDELKIKEMALETSLNSKIFDVTAINANAGVLKD CIEKRQLLKK
Form: Lyophilized
Buffer: PBS, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: any condition
Delivery lead time in business days: 5-7
Image: PX-P4005.jpg

30 other products in the same category: