Login to display prices
Login to display prices
Human Growth hormone 1 isoform 1 recombinant protein View larger

Human Growth hormone 1 isoform 1 recombinant protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human Growth hormone 1 isoform 1 recombinant protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human Growth hormone 1 isoform 1 recombinant protein

Protein delivered with tag?: No
Size: 10 ug
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 22.24kDa
Purity estimated: 0.9
Uniprot id: B1A4G6
Uniprot link: http://www.uniprot.org/uniprot/B1A4G6
Aliases / synonyms: hGH(15N labeled, expressed with M9 medium)
Protein sequence (w/o tag): GPFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Form: Frozen
Buffer: 50mM Tris-HCl pH 7.0, 150mM NaCl
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Image: PX-P4003.jpg

30 other products in the same category: