Login to display prices
Login to display prices
Human HMGB1 extracellular recombinant protein View larger

Human HMGB1 extracellular recombinant protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human HMGB1 extracellular recombinant protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesMammalian

More info about Human HMGB1 extracellular recombinant protein

Proteogenix reference: PX-P4002-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human HMGB1 extracellular recombinant protein
Fragment type: Full-length
Expression system: Eukaryotic expression
Molecular weight with tag if any: 26.97kDa
Purity estimated: 0.85
Spec:entrez geneid: 3146
Uniprot id: P09429
Uniprot link: http://www.uniprot.org/uniprot/P09429
Aliases / synonyms: Amphoterin, Chromosomal protein, nonhistone, HMG1, DKFZp686A04236, High mobility group 1, High mobility group box 1, High mobility group protein 1, High mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, HMG-1, HMG1, HMG3, HMGB 1, HMGB1, HMGB1_HUMAN, NONHISTONE CHROMOSOMAL PROTEIN HMG1, SBP 1, Sulfoglucuronyl carbohydrate binding protein
Protein sequence (w/o tag): MGSHHHHHHSGLEVLFQGPMGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)

30 other products in the same category: