Elizabethkingia miricola PNGaseF Recombinant Protein-15000u View larger

Elizabethkingia miricola PNGaseF Recombinant Protein-15000u

New product

135,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Elizabethkingia miricola PNGaseF Recombinant Protein-15000u

BrandProteoGenix
Product typeProteins
Origin speciesSchizosaccharomyces pombe
Host speciesEscherichia coli (E. coli)

More info about Elizabethkingia miricola PNGaseF Recombinant Protein-15000u

Brand: ProteoGenix
Proteogenix reference: PX-P3070-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Elizabethkingia miricola PNGaseF Recombinant Protein-15000u
Fragment type: Partial
Origin species: Schizosaccharomyces pombe
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 45,52 kDa
Purity estimated: 0.9
Ncbi reference: NP_588151.1
Uniprot id: P21163
Uniprot link: http://www.uniprot.org/uniprot/P21163
Aliases / synonyms: Peptide -N-Glycosidase F, PNGase F, PNGaseF
Protein sequence (w/o tag): MAHNHRHKHKLSVHSDNQSQISIEVGRDAPAAAATDLSGIIGPQMTKSPASSVTHFSTPSMLPIGGTSLDDELLAPVDDL NLDLGLDDLLGDEQGANAPAIEADEQAETSSIHLPSDIMEDDSSRPAAAGVEEGQVVESATAPQQEKINPQKTVRRQRAI IDPVTELSSKQMKKQLADTSSITSPLCLNTSSIVFNATVNFTRNGKFNTSIFSSNLNPKVNELLQADFKQAILRKRKNES PEEVEPAKHQRTDTSTENQETAEVLDPEEIAAAELANITEAAIATLPQETVVQPEGEAPELGSPMGFPVTALESADDSLF DAPPVMLDEADLLGSERLDSSVSEALPSSQTAKDSLRNKWDPYTEGEKVSFQTLSAGCNREEAVQLFFDVLVLATKDVIS VKQDVAIQNEITLTAKRGMLLSSL
Form: liquid
Buffer: PBS, imidazole 300mM
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human ChromograninA Partial [19-457] Recombinant Protein
- Human HMGB1 intracellular recombinant protein
- Human HMGB1 extracellular recombinant protein
Description: PNGase F is a recombinant glycosidase cloned from Elizabethkingia miricola and overexpressed in E. coli. It cleaves a complete glycan from a glycoprotein and it deaminates the asparagine to aspartic acid, but leaves the oligosaccharide undamaged. PNGase F will not eliminate oligosaccharides containing Alpha-(1, 3)-linked core fucose usually found in plant glycoproteins. A tri-peptide with the oligosaccharide-linked asparagine as the central residue is the minimal substrate for PNGase F.
Publications: 1: Kuhn P, Tarentino AL, Plummer TH Jr, Van Roey P. Crystal structure of peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine amidase F at 2.2-A resolution. Biochemistry. 1994 Oct 4;33(39):11699-706. PubMed PMID: 7918386. 2: Norris GE, Stillman TJ, Anderson BF, Baker EN. The three-dimensional structure of PNGase F, a glycosylasparaginase from Flavobacterium meningosepticum. Structure. 1994 Nov 15;2(11):1049-59. PubMed PMID: 7881905. 3: Kuhn P, Guan C, Cui T, Tarentino AL, Plummer TH Jr, Van Roey P. Active site and oligosaccharide recognition residues of peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine amidase F. J Biol Chem. 1995 Dec 8;270(49):29493-7. PubMed PMID: 7493989. 4: Lemp D, Haselbeck A, Klebl F. Molecular cloning and heterologous expression of N-glycosidase F from Flavobacterium meningosepticum. J Biol Chem. 1990 Sep 15;265(26):15606-10. PubMed PMID: 2203781. 5: Barsomian GD, Johnson TL, Borowski M, Denman J, Ollington JF, Hirani S, McNeilly DS, Rasmussen JR. Cloning and expression of peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine amidase F in Escherichia coli. J Biol Chem. 1990 Apr 25;265(12):6967-72. PubMed PMID: 2182635. 6: Tarentino AL, Quinones G, Trumble A, Changchien LM, Duceman B, Maley F, Plummer TH Jr. Molecular cloning and amino acid sequence of peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine amidase from flavobacterium meningosepticum. J Biol Chem. 1990 Apr 25;265(12):6961-6. Erratum in: J Biol Chem 1990 Jul 5;265(19):11405. PubMed PMID: 2182634.

Buy Elizabethkingia miricola PNGaseF Recombinant Protein-15000u now

Add to cart