Login to display prices
Login to display prices
Zika ZGE Recombinant Protein/Genome polyprotein View larger

Zika ZGE Recombinant Protein/Genome polyprotein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Zika ZGE Recombinant Protein/Genome polyprotein

BrandProteoGenix
Product typeProteins
Origin speciesZika
Host speciesEscherichia coli (E. coli)

More info about Zika ZGE Recombinant Protein/Genome polyprotein

Proteogenix reference: PX-P3065-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Zika ZGE Recombinant Protein/Genome polyprotein
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 54.6 kDa
Purity estimated: 0.85
Uniprot id: A0A140E7U5
Uniprot link: http://www.uniprot.org/uniprot/A0A140E7U5
Aliases / synonyms: ZGE, Genome polyprotein
Protein sequence (w/o tag): MIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTAMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMLVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLAHKEWFHDIPLPWHAGAATGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETVDGTVTVEGQYGGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIIGAAFKLEHHHHHH
Form: Frozen
Buffer: PBS,pH7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Image: PX-P3065.jpg
Description: The genome of Zika virus encodes a single polyprotein that is co- and post-translationally cleaved to generate 13 proteins. For example the peptide pr prevents premature fusion activity of envelope proteins in trans Golgi by binding to envelope protein E at pH6.0. After virion release in extracellular space gets dissociated from E dimers. Non-structural protein 4A induces host endoplasmic regulate the ATPase activity of the NS3 helicase. Non-structural protein 1 is implicated in immune evasion, pathogenesis and viral replication. Once cleaved off the polyprotein is targeted to three destinations: the viral replication cycle, the plasma membrane and the extracellular compartment. It may play a role in viral genome replication etc.
Publications: 1. "Complete Genome Sequence of Zika Virus from the First Imported Case in Mainland China." Liu L., Wu W., Zhao X., Xiong Y., Zhang S., Liu X., Qu J., Li J., Nei K., Liang M., Shu Y., Hu G., Ma X., Li D. Genome Announc. 4:e00291-16(2016) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Category: Sequences. Strain: VE_GanxianImported. Source: UniProtKB/TrEMBL (unreviewed).

30 other products in the same category: