Login to display prices
Login to display prices
Rainbow trout rtCD64s Recombinant Protein View larger

Rainbow trout rtCD64s Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Rainbow trout rtCD64s Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesRainbow trout
Host speciesEscherichia coli (E. coli)

More info about Rainbow trout rtCD64s Recombinant Protein

Proteogenix reference: PX-P3064-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Rainbow trout rtCD64s Recombinant Protein
Fragment type: Unknown
Expression system: Prokaryotic expression
Molecular weight with tag if any: 34.74 kDa
Purity estimated: 0.9
Aliases / synonyms: rtCD64s
Protein sequence (w/o tag): QVLPTSAPQTAVAELVKGLPWIFSGESVHLKCSVPGNVSAEWRYRWFRGGEQLQESEYFVLWKARPQQSGKYYCRGLRTTWINTQHTLHSLPIEIEVDGGWAILQAPPLPMLVGETMTLTCRVRNNPKLTEVILYKDGVELQIQRGPELRVTNLTLQHHGSYWCRASWDGRRETNSVISVAAPVSIVEVLTEPMLEIVPNDPLIHKDRMLLVCHVQLNARQPVPHIHYYFYQDGLSLGPASSQDKITVLRDSGQYWCKASVPTLGLKRLSKPLGYGRVTGEPSEHLRMRNQKIIVVPLGSHHHHHH
Form: Frozen
Buffer: PBS pH 7.5 +urea 8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25

30 other products in the same category: