Human Engrailed1 Recombinant Protein View larger

Human Engrailed1 Recombinant Protein

New product

204,75 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human Engrailed1 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human Engrailed1 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3062-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human Engrailed1 Recombinant Protein
Fragment type: Full-length
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 42.14 kDa
Purity estimated: 0.6
Aliases / synonyms: Engrailed1
Protein sequence (w/o tag): MGSHHHHHHSGENLYFQGMEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
Form: Frozen
Buffer: PO4(pH:7.4) 20 mM with about 0.5M NaCl
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Related products: - Rainbow trout rtCD64s Recombinant Protein
- Zika ZGE Recombinant Protein/Genome polyprotein
- Human MpigF Recombinant Protein

Buy Human Engrailed1 Recombinant Protein now

Add to cart