Login to display prices
Login to display prices
Human Engrailed1 Recombinant Protein View larger

Human Engrailed1 Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human Engrailed1 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human Engrailed1 Recombinant Protein

Proteogenix reference: PX-P3062-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human Engrailed1 Recombinant Protein
Fragment type: Full-length
Expression system: Prokaryotic expression
Molecular weight with tag if any: 42.14 kDa
Purity estimated: 0.6
Aliases / synonyms: Engrailed1
Protein sequence (w/o tag): MGSHHHHHHSGENLYFQGMEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
Form: Frozen
Buffer: PO4(pH:7.4) 20 mM with about 0.5M NaCl
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7

30 other products in the same category: