Login to display prices
Login to display prices
Human CD20 Recombinant Protein View larger

Human CD20 Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human CD20 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesMammalian

More info about Human CD20 Recombinant Protein

Proteogenix reference: PX-P3060-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human CD20 Recombinant Protein
Fragment type: Partial
Expression system: Eukaryotic expression
Molecular weight with tag if any: 10.98 kDa
Purity estimated: 0.9
Ncbi reference: P11836
Uniprot id: P11836
Uniprot link: http://www.uniprot.org/uniprot/P11836
Aliases / synonyms: B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD_antigen: CD20, MS4A1
Protein sequence (w/o tag): MGSHHHHHHSGENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPE PPQDQESSPIENDSSP
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Image: PX-P3060.jpg
Description: CD20 also known as MS4A1 is a part of the membrane-spanning 4A gene family. It is expressed on all steps of B cell development except the first and last one. It is a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. CD20 may be implicated in the regulation of B-cell activation and proliferation. Defects in MS4A1 are the source of immunodeficiency common variable type 5 (CVID5). CVID5 is a primary immunodeficiency represented by antibody insufficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The deficiency results from a breakdown of B-cell differentiation and defective secretion of immunoglobulin, the counts of circulating B-cells is generally in the normal range, but can be low.
Publications: 1: Meissner JM, Toporkiewicz M, Czogalla A, Matusewicz L, Kuliczkowski K, Sikorski AF. Novel antisense therapeutics delivery systems: In vitro and in vivo studies of liposomes targeted with anti-CD20 antibody. J Control Release. 2015 Dec 28;220(Pt A):515-28. doi: 10.1016/j.jconrel.2015.11.015. Epub 2015 Nov 14. PubMed PMID: 26585505. 2: Li J, Zhao S, Wang J, Chen J, Wen W, Zhang Q. CD20-negative diffuse large B cell lymphoma: a comprehensive analysis of 695 cases. Tumour Biol. 2016 Mar;37(3):3619-37. doi: 10.1007/s13277-015-4205-5. Epub 2015 Oct 12. Review. PubMed PMID: 26459310. 3: Salva KA, Bennett D, Longley J, Guitart J, Wood GS. Multispectral Imaging Approach to the Diagnosis of a CD20+ Cutaneous T-cell Lymphoproliferative Disorder: A Case Report. Am J Dermatopathol. 2015 Oct;37(10):e116-21. doi: 10.1097/DAD.0000000000000323. PubMed PMID: 26381030; PubMed Central PMCID: PMC4576727. 4: Gu L, Hong L, Ling Z, Feng J, Zheng Z, Du L, Mou H, Sun W, Kong X, Ling Y, Jiang Z, Zhu C, Mao W, Qian L. Establishment and Characterization of a CD20-Positive NK/T-Cell Lymphoma Cell Line. Clin Lab. 2015;61(7):731-9. PubMed PMID: 26299072. 5: Degheidy H, Abbasi F, Mostowski H, Gaigalas AK, Marti G, Bauer S, Wang L. Consistent, multi-instrument single tube quantification of CD20 in antibody bound per cell based on CD4 reference. Cytometry B Clin Cytom. 2016 Mar;90(2):159-67. doi: 10.1002/cyto.b.21253. Epub 2015 Jul 6. PubMed PMID: 26013593. 6: Vauchy C, Gamonet C, Ferrand C, Daguindau E, Galaine J, Beziaud L, Chauchet A, Henry Dunand CJ, Deschamps M, Rohrlich PS, Borg C, Adotevi O, Godet Y. CD20 alternative splicing isoform generates immunogenic CD4 helper T epitopes. Int J Cancer. 2015 Jul 1;137(1):116-26. doi: 10.1002/ijc.29366. Epub 2014 Dec 12. PubMed PMID: 25449106. 7: Khedmat H, Ghamar-Chehreh ME, Amini M. Significance of CD20 expression by lymphoproliferative lesions developing after liver transplantation: post-transplant lymphoproliferative disorders international survey. Saudi J Kidney Dis Transpl. 2014 Nov;25(6):1293-300. Review. PubMed PMID: 25394454. 8: Palanichamy A, Jahn S, Nickles D, Derstine M, Abounasr A, Hauser SL, Baranzini SE, Leppert D, von Büdingen HC. Rituximab efficiently depletes increased CD20-expressing T cells in multiple sclerosis patients. J Immunol. 2014 Jul 15;193(2):580-6. doi: 10.4049/jimmunol.1400118. Epub 2014 Jun 13. PubMed PMID: 24928997; PubMed Central PMCID: PMC4082756. 9: Zhang LN, Wang L, Fang C, Zou ZJ, Fan L, Zhang R, Young KH, Li JY, Xu W. The significance of single nucleotide polymorphism rs2070770 in CD20 gene in Chinese patients with diffuse large B-cell lymphoma. Leuk Lymphoma. 2015 Mar;56(3):676-81. doi: 10.3109/10428194.2014.927455. Epub 2014 Jul 17. PubMed PMID: 24898664. 10: Harms KL, Harms PW, Anderson T, Betz BL, Ross CW, Fullen DR, Hristov AC. Mycosis fungoides with CD20 expression: report of two cases and review of the literature. J Cutan Pathol. 2014 Jun;41(6):494-503. doi: 10.1111/cup.12299. Epub 2014 Feb 26. Review. PubMed PMID: 24467775. 11: Liu J, Gu Z, Yang Y, Wendlandt E, Xu H. A subset of CD20(+) MM patients without the t(11;14) are associated with poor prognosis and a link to aberrant expression of Wnt signaling. Hematol Oncol. 2014 Dec;32(4):215-7. doi: 10.1002/hon.2120. Epub 2014 Jan 9. PubMed PMID: 24408089; PubMed Central PMCID: PMC4449615. 12: Batran SE, Salih MM, Elhassan EM, Mohmmed AA, Adam I. CD20, CD3, placental malaria infections and low birth weight in an area of unstable malaria transmission in Central Sudan. Diagn Pathol. 2013 Nov 18;8:189. doi: 10.1186/1746-1596-8-189. PubMed PMID: 24245949; PubMed Central PMCID: PMC3937234. 13: Jullié ML, Carlotti M, Vivot A Jr, Beylot-Barry M, Ortonne N, Frouin E, Carlotti A, de Muret A, Balme B, Franck F, Merlio JP, Vergier B. CD20 antigen may be expressed by reactive or lymphomatous cells of transformed mycosis fungoides: diagnostic and prognostic impact. Am J Surg Pathol. 2013 Dec;37(12):1845-54. doi: 10.1097/PAS.0000000000000091. PubMed PMID: 24145652. 14: Fang C, Zhuang Y, Wang L, Fan L, Wu YJ, Zhang R, Zou ZJ, Zhang LN, Yang S, Xu W, Li JY. High levels of CD20 expression predict good prognosis in chronic lymphocytic leukemia. Cancer Sci. 2013 Aug;104(8):996-1001. doi: 10.1111/cas.12192. Epub 2013 Jun 7. PubMed PMID: 23659384. 15: Jiqiu W, Jinsong C, Dongrui C, Mingchao Z, Shuming J, Zhi-Hong L. CD20+ B-cell infiltration is related to the time after transplant and poor prognosis of acute cellular rejection in renal transplant. Exp Clin Transplant. 2013 Oct;11(5):412-7. doi: 10.6002/ect.2012.0143. Epub 2013 Feb 21. PubMed PMID: 23428174. 16: Jiang QP, Liu SY, Yang YX, Tan XX, Peng J, Xiong ZT, Li Z. CD20-positive NK/T-cell lymphoma with indolent clinical course: report of case and review of literature. Diagn Pathol. 2012 Oct 2;7:133. doi: 10.1186/1746-1596-7-133. Review. PubMed PMID: 23031227; PubMed Central PMCID: PMC3502398.

30 other products in the same category: