Login to display prices
Login to display prices
Human VEGFR Recombinant Protein View larger

Human VEGFR Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human VEGFR Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesMammalian

More info about Human VEGFR Recombinant Protein

Proteogenix reference: PX-P3059-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human VEGFR Recombinant Protein
Fragment type: Partial
Expression system: Eukaryotic expression
Molecular weight with tag if any: 86.24 kDa
Purity estimated: 0.9
Ncbi reference: P35968
Uniprot id: P35968
Uniprot link: http://www.uniprot.org/uniprot/P35968
Aliases / synonyms: Vascular endothelial growth factor receptor 2, KDR,VEGFR-2, Fetal liver kinase 1, FLK-1, Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1, CD309
Protein sequence (w/o tag): MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECS DGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVS LCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNST FVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVIL TNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPY PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQ PTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDY VCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEGSHHHHHH
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Image: PX-P3059.jpg

30 other products in the same category: