Login to display prices
Login to display prices
Human TNFa Recombinant Protein View larger

Human TNFa Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human TNFa Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesMammalian

More info about Human TNFa Recombinant Protein

Proteogenix reference: PX-P3058-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human TNFa Recombinant Protein
Fragment type: Partial
Expression system: Eukaryotic expression
Molecular weight with tag if any: 18.56 kDa
Purity estimated: 0.9
Ncbi reference: P01375
Uniprot id: P01375
Uniprot link: http://www.uniprot.org/uniprot/P01375
Aliases / synonyms: DIF, TNF-A, TNFSF2, Cachectin, Tumor Necrosis Factor Ligand Superfamily Member 2,Tumor Necrosis Factor Alpha, TNFa
Protein sequence (w/o tag): MGSHHHHHHSGVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGC PSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQ VYFGIIAL
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Image: PX-P3058.jpg

30 other products in the same category: