Login to display prices
Login to display prices
Tilapia nilotica HSP70 Recombinant Protein View larger

Tilapia nilotica HSP70 Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Tilapia nilotica HSP70 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesTilapia nilotica
Host speciesYeast

More info about Tilapia nilotica HSP70 Recombinant Protein

Proteogenix reference: PX-P3054-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Tilapia nilotica HSP70 Recombinant Protein
Fragment type: Full-length
Expression system: Eukaryotic expression
Molecular weight with tag if any: 70.26 kDa
Purity estimated: 0.9
Ncbi reference: B6E947
Uniprot id: B6E947
Uniprot link: http://www.uniprot.org/uniprot/B6E947
Aliases / synonyms: HSP-A4, APG2, HS24/P52, RY, Hsp70, Hsp70RY, Heat shock 70-related protein APG-2
Protein sequence (w/o tag): MSAAKGVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ VALNPSNTVFDAKRLIGRKFDEPVVQADMKHWPFKVISDGGKPKIRVEYKGEDKAFYPEE ISSMVLVKMKEIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA AAIAYGLDKGKSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV NHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGVDFYTSIT RARFEELCSDLFRGTLEPVEKSLRDAKLDKGQIHDVVLVGGSTRIPKIQKLLQDFFNGRE LNKSINPDEAVAYGAAVQAAILSGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNT TIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTF DVDANGILNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDLQRDKIAA KNSLESYAFNMKSSVQDDNLKGKISEEDKKKVVEKCDEAIAWLENNQLADKEEYQHKQKE LEKVCNPIISKLYQGGMPTGATCGEQARAGSQGPTIEEVD
Form: Frozen
Buffer: Tris 50mM, NaCl 150mM ,pH 8.0
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7

30 other products in the same category: