Tilapia nilotica HSP70 Recombinant Protein View larger

Tilapia nilotica HSP70 Recombinant Protein

New product

135,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Tilapia nilotica HSP70 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesTilapia nilotica
Host speciesYeast

More info about Tilapia nilotica HSP70 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3054-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Tilapia nilotica HSP70 Recombinant Protein
Fragment type: Full-length
Origin species: Tilapia nilotica
Expression system: Eukaryotic expression
Host species: Yeast
Molecular weight with tag if any: 70.26 kDa
Purity estimated: 0.9
Ncbi reference: B6E947
Uniprot id: B6E947
Uniprot link: http://www.uniprot.org/uniprot/B6E947
Aliases / synonyms: HSP-A4, APG2, HS24/P52, RY, Hsp70, Hsp70RY, Heat shock 70-related protein APG-2
Protein sequence (w/o tag): MSAAKGVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ VALNPSNTVFDAKRLIGRKFDEPVVQADMKHWPFKVISDGGKPKIRVEYKGEDKAFYPEE ISSMVLVKMKEIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA AAIAYGLDKGKSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV NHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGVDFYTSIT RARFEELCSDLFRGTLEPVEKSLRDAKLDKGQIHDVVLVGGSTRIPKIQKLLQDFFNGRE LNKSINPDEAVAYGAAVQAAILSGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNT TIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTF DVDANGILNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDLQRDKIAA KNSLESYAFNMKSSVQDDNLKGKISEEDKKKVVEKCDEAIAWLENNQLADKEEYQHKQKE LEKVCNPIISKLYQGGMPTGATCGEQARAGSQGPTIEEVD
Form: Frozen
Buffer: Tris 50mM, NaCl 150mM ,pH 8.0
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Related products: - Listeria monocytogenes Invasion associated protein p60 Recombinant Protein
- Human Eosinophil cationic protein(ECP) Recombinant Protein
- Human TNFa Recombinant Protein

Buy Tilapia nilotica HSP70 Recombinant Protein now

Add to cart