Human CD63 Recombinant Protein View larger

Human CD63 Recombinant Protein

New product

135,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human CD63 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human CD63 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3052-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human CD63 Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 10.96 kDa
Purity estimated: 0.8
Ncbi reference: P08962
Uniprot id: P08962
Uniprot link: http://www.uniprot.org/uniprot/P08962
Aliases / synonyms: CD63, LAMP-3, ME491, MLA1, OMA81H, Melanoma 1 antigen, Granulophysin, Lysosomal-associated membrane protein 3, Ocular melanoma-associated antigen
Protein sequence (w/o tag): RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human SOX2 Recombinant Protein
- Tilapia nilotica HSP70 Recombinant Protein
- Listeria monocytogenes Invasion associated protein p60 Recombinant Protein

Buy Human CD63 Recombinant Protein now

Add to cart