Login to display prices
Login to display prices
Human TSG101 Recombinant Protein View larger

Human TSG101 Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human TSG101 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human TSG101 Recombinant Protein

Proteogenix reference: PX-P3051-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human TSG101 Recombinant Protein
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 17.44 kDa
Purity estimated: 0.8
Ncbi reference: Q99816
Uniprot id: Q99816
Uniprot link: http://www.uniprot.org/uniprot/Q99816
Aliases / synonyms: TSG10, VPS23, Tumor Susceptibility Gene 10, ESCRT-I complex subunit TSG101,Tumor Susceptibility Gene 101
Protein sequence (w/o tag): MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25

30 other products in the same category: