Human TSG101 Recombinant Protein View larger

Human TSG101 Recombinant Protein

New product

135,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human TSG101 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human TSG101 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3051-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human TSG101 Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 17.44 kDa
Purity estimated: 0.8
Ncbi reference: Q99816
Uniprot id: Q99816
Uniprot link: http://www.uniprot.org/uniprot/Q99816
Aliases / synonyms: TSG10, VPS23, Tumor Susceptibility Gene 10, ESCRT-I complex subunit TSG101,Tumor Susceptibility Gene 101
Protein sequence (w/o tag): MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human CD63 Recombinant Protein
- Human SOX2 Recombinant Protein
- Tilapia nilotica HSP70 Recombinant Protein

Buy Human TSG101 Recombinant Protein now

Add to cart