Login to display prices
Login to display prices
Human RETN Recombinant Protein View larger

Human RETN Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human RETN Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human RETN Recombinant Protein

Proteogenix reference: PX-P3048-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human RETN Recombinant Protein
Fragment type: Unknown
Expression system: Prokaryotic expression
Molecular weight with tag if any: 10.55 kDa
Purity estimated: 0.95
Ncbi reference: Q9HD89
Uniprot id: Q9HD89
Uniprot link: http://www.uniprot.org/uniprot/Q9HD89
Aliases / synonyms: ADSF, FIZZ3, RETN1, RSTN, XCP1, Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted FIZZ3, Resistin
Protein sequence (w/o tag): SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7

30 other products in the same category: