Human RETN Recombinant Protein View larger

Human RETN Recombinant Protein

New product

135,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human RETN Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human RETN Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3048-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human RETN Recombinant Protein
Fragment type: Unknown
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 10.55 kDa
Purity estimated: 0.95
Ncbi reference: Q9HD89
Uniprot id: Q9HD89
Uniprot link: http://www.uniprot.org/uniprot/Q9HD89
Aliases / synonyms: ADSF, FIZZ3, RETN1, RSTN, XCP1, Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted FIZZ3, Resistin
Protein sequence (w/o tag): SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Related products: - Human SLC3A1 Recombinant Protein
- Human SRC Recombinant Protein
- Human TSG101 Recombinant Protein

Buy Human RETN Recombinant Protein now

Add to cart