Human PDCD6IP Recombinant Protein View larger

Human PDCD6IP Recombinant Protein

New product

204,75 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human PDCD6IP Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human PDCD6IP Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3047-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human PDCD6IP Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 44.48 kDa
Purity estimated: 0.95
Ncbi reference: Q8WUM4
Uniprot id: Q8WUM4
Uniprot link: http://www.uniprot.org/uniprot/Q8WUM4
Aliases / synonyms: PDCD6-IP, AIP1, Alix, DRIP4, HP95, ALG-2 Interacting Protein X,Programmed Cell Death Protein 6 Interacting Protein, PDCD6IP
Protein sequence (w/o tag): MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLA
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human RETN Recombinant Protein
- Human SLC3A1 Recombinant Protein
- Human SRC Recombinant Protein

Buy Human PDCD6IP Recombinant Protein now

Add to cart