Human KLK3 Recombinant Protein View larger

Human KLK3 Recombinant Protein

New product

135,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human KLK3 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human KLK3 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3045-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human KLK3 Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 26.92 kDa
Purity estimated: 0.9
Ncbi reference: P07288
Uniprot id: P07288
Uniprot link: http://www.uniprot.org/uniprot/P07288
Aliases / synonyms: Kallikrein 3,KLK3, APS, KLK2A1, PSA, HK3, KLKB1, Seminin, Prostate Specific Antigen, Kallikrein-Related Peptidase 3, Semenogelase, g-Seminoprotein, P-30 Antigen, Plasma kallikrein
Protein sequence (w/o tag): IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human LRP1 Recombinant Protein
- Human PDCD6IP Recombinant Protein
- Human RETN Recombinant Protein

Buy Human KLK3 Recombinant Protein now

Add to cart