Login to display prices
Login to display prices
Human ICAM1/CD54 Recombinant Protein View larger

Human ICAM1/CD54 Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human ICAM1/CD54 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human ICAM1/CD54 Recombinant Protein

Proteogenix reference: PX-P3044-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human ICAM1/CD54 Recombinant Protein
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 50.34 kDa
Purity estimated: 0.95
Ncbi reference: P05362
Uniprot id: P05362
Uniprot link: http://www.uniprot.org/uniprot/P05362
Aliases / synonyms: CD54, BB2, P3.58, Human Rhinovirus Receptor, Major group rhinovirus receptor, Intercellular Adhesion Molecule 1, Major group rhinovirus receptor, ICAM-1
Protein sequence (w/o tag): QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Image: PX-P3044.jpg
Description: Intercellular Adhesion Molecule-1 (ICAM-1) also known as CD54 has 7 potential N-linked glycosylation sites. It is a single chain membrane glycoprotein present on the surface of a multiple non-hematopoietic and hematopoietic cell types and has a function in signal transduction, cell signaling and lymphocyte adhesion. ICAM-1 mediates cell adhesion by binding to integrin CD11a/CD18 (leukocyte adhesion molecule, LFA-1) and to CD11b/CD18 (Mac-1). Soluble ICAM-1 is found in a biologically active form in serum and is elevated in patients with diversified inflammatory conditions.
Publications: 1: Igarashi Y, Morishita Y, Yoshizawa H, Imai R, Imai T, Hirahara I, Akimoto T, Ookawara S, Ishibashi K, Muto S, Nagata D. The association between soluble intercellular adhesion molecule-1 levels in drained dialysate and peritoneal injury in peritoneal dialysis. Ren Fail. 2017 Nov;39(1):392-399. doi: 10.1080/0886022X.2017.1287735. PubMed PMID: 28201944. 2: Chang PY, Tsao SM, Chang JH, Chien MH, Hung WY, Huang YW, Yang SF. Plasma levels of soluble intercellular adhesion molecule-1 as a biomarker for disease severity of patients with community-acquired pneumonia. Clin Chim Acta. 2016 Dec 1;463:174-180. doi: 10.1016/j.cca.2016.10.030. Epub 2016 Oct 28. PubMed PMID: 27983998. 3: Lee YH, Bae SC. Intercellular adhesion molecule-1 polymorphisms, K469E and G261R and susceptibility to vasculitis and rheumatoid arthritis: a meta-analysis. Cell Mol Biol (Noisy-le-grand). 2016 Oct 31;62(12):84-90. doi: 10.14715/cmb/2016.62.12.15. PubMed PMID: 27894415. 4: Schaefer M, Sarkar S, Schwarz M, Friebe A. Soluble Intracellular Adhesion Molecule-1 in Patients with Unipolar or Bipolar Affective Disorders: Results from a Pilot Trial. Neuropsychobiology. 2016;74(1):8-14. doi: 10.1159/000446919. Epub 2016 Jul 22. PubMed PMID: 27442531. 5: Sharma S, Singh SK, Kakkar K, Nyari N, Singh D, Dhole TN, Kashyap R, Hasan S. Association of ICAM-1 K469E polymorphism with dengue infection in North Indian population. Microb Pathog. 2016 Jul;96:80-4. doi: 10.1016/j.micpath.2016.05.006. Epub 2016 May 11. PubMed PMID: 27179462. 6: Novikov VV, Shumilova SV, Novikov DV, Kalugin AV, Fomina SG, Karaulov AV. Genetic Instability in Locus rs5498 E469K (A/G) of ICAM-1 Gene in Patients with Colorectal Cancer and Breast Cancer. Bull Exp Biol Med. 2016 Apr;160(6):811-3. doi: 10.1007/s10517-016-3316-3. Epub 2016 May 12. PubMed PMID: 27169635. 7: Yousuf SD, Ganie MA, Zargar MA, Parvez T, Rashid F. The ICAM-1 Gly241Arg Polymorphism is Not Associated With Polycystic Ovary Syndrome - Results from a Case Control study in Kashmir, India. Asian Pac J Cancer Prev. 2016;17(3):1583-8. PubMed PMID: 27039809. 8: Poniedziałek-Czajkowska E, Mierzyński R, Szymula D, Leszczyńska-Gorzelak B, Oleszczuk J. Intercellular Adhesion Molecule and Endogenous NOS Inhibitor: Asymmetric Dimethylarginine in Pregnant Women with Gestational Diabetes Mellitus. J Diabetes Res. 2016;2016:1342643. doi: 10.1155/2016/1342643. Epub 2016 Feb 11. PubMed PMID: 26981539; PubMed Central PMCID: PMC4766337. 9: Zhang X, Huang J, Bai J, Lu W, Zhang M, Mei H. Association of Polymorphisms in Intercellular Adhesion Molecule 1 (ICAM-1) Gene with Cancer Susceptibility: A Meta-Analysis of 14 Case-Control Studies. Med Sci Monit. 2016 Feb 21;22:569-79. PubMed PMID: 26897511; PubMed Central PMCID: PMC4763808. 10: Tang DD, Niu HX, Peng FF, Long HB, Liu ZR, Zhao H, Chen YH. Hypochlorite-Modified Albumin Upregulates ICAM-1 Expression via a MAPK-NF-κB Signaling Cascade: Protective Effects of Apocynin. Oxid Med Cell Longev. 2016;2016:1852340. doi: 10.1155/2016/1852340. Epub 2016 Jan 10. PubMed PMID: 26881015; PubMed Central PMCID: PMC4736979. 11: Di D, Chen L, Wang L, Sun P, Liu Y, Xu Z, Ju J. Downregulation of human intercellular adhesion molecule-1 attenuates the metastatic ability in human breast cancer cell lines. Oncol Rep. 2016 Mar;35(3):1541-8. doi: 10.3892/or.2016.4543. Epub 2016 Jan 5. PubMed PMID: 26751847. 12: Wang D, Zhang FH, Zhao YT, Xiao XG, Liu S, Shi HB, Lin AL, Wang YJ, Han Q, Sun QM. Association of polymorphism in ICAM-1 (K469E) and cytology parameters in patients' initial blood test with acute ischemic stroke. Genet Mol Res. 2015 Dec 2;14(4):15520-9. doi: 10.4238/2015.December.1.2. PubMed PMID: 26634518. 13: Taranta-Janusz K, Wasilewska A, Roszkowska R, Michaluk-Skutnik J. Is urine intercellular adhesion molecule-1 a marker of renal disorder in children with ureteropelvic junction obstruction? Biomarkers. 2016;21(2):123-8. doi: 10.3109/1354750X.2015.1118543. Epub 2015 Dec 3. PubMed PMID: 26631256. 14: Tsai ST, Wang PJ, Liou NJ, Lin PS, Chen CH, Chang WC. ICAM1 Is a Potential Cancer Stem Cell Marker of Esophageal Squamous Cell Carcinoma. PLoS One. 2015 Nov 16;10(11):e0142834. doi: 10.1371/journal.pone.0142834. eCollection 2015. PubMed PMID: 26571024; PubMed Central PMCID: PMC4646358. 15: Othumpangat S, Noti JD, McMillen CM, Beezhold DH. ICAM-1 regulates the survival of influenza virus in lung epithelial cells during the early stages of infection. Virology. 2016 Jan;487:85-94. doi: 10.1016/j.virol.2015.10.005. Epub 2015 Oct 23. PubMed PMID: 26499045; PubMed Central PMCID: PMC4719144.

30 other products in the same category: