Human EGF Recombinant Protein View larger

Human EGF Recombinant Protein

New product

135,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human EGF Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human EGF Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3041-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human EGF Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 33.19 kDa
Purity estimated: 0.9
Ncbi reference: P01133
Uniprot id: P01133
Uniprot link: http://www.uniprot.org/uniprot/P01133
Aliases / synonyms: Epidermal Growth Factor, EGF, URG, Beta-Urogastrone, Pro-epidermal growth factor
Protein sequence (w/o tag): NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Related products: - Human FLOT1 Recombinant Protein
- Human HSPA8 Recombinant Protein
- Human ICAM1/CD54 Recombinant Protein

Buy Human EGF Recombinant Protein now

Add to cart