Login to display prices
Login to display prices
Human EGF Recombinant Protein View larger

Human EGF Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human EGF Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human EGF Recombinant Protein

Proteogenix reference: PX-P3041-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human EGF Recombinant Protein
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 33.19 kDa
Purity estimated: 0.9
Ncbi reference: P01133
Uniprot id: P01133
Uniprot link: http://www.uniprot.org/uniprot/P01133
Aliases / synonyms: Epidermal Growth Factor, EGF, URG, Beta-Urogastrone, Pro-epidermal growth factor
Protein sequence (w/o tag): NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7

30 other products in the same category: