Human CD9 Recombinant Protein View larger

Human CD9 Recombinant Protein

New product

135,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human CD9 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human CD9 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3040-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human CD9 Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 10.5 kDa
Purity estimated: 0.9
Ncbi reference: P21926
Uniprot id: P21926
Uniprot link: http://www.uniprot.org/uniprot/P21926
Aliases / synonyms: CD9, TSPAN29, 5H9, BA2, BTCC-1, DRAP-27, GIG2, MIC3, P24, Tetraspanin 29, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3,Motility Related Protein
Protein sequence (w/o tag): SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human EGF Recombinant Protein
- Human FLOT1 Recombinant Protein
- Human HSPA8 Recombinant Protein

Buy Human CD9 Recombinant Protein now

Add to cart