Human CD81 Recombinant Protein View larger

Human CD81 Recombinant Protein

New product

135,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human CD81 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human CD81 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3039-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human CD81 Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 10.59 kDa
Purity estimated: 0.8
Ncbi reference: P60033
Uniprot id: P60033
Uniprot link: http://www.uniprot.org/uniprot/P60033
Aliases / synonyms: CD81, S5.7, TAPA1, TSPAN28, Tetraspanin 28, Target Of Antiproliferative Antibody 1, 26 kDa cell surface protein TAPA-1
Protein sequence (w/o tag): FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human CD9 Recombinant Protein
- Human EGF Recombinant Protein
- Human FLOT1 Recombinant Protein

Buy Human CD81 Recombinant Protein now

Add to cart