Human CAV1 Recombinant Protein View larger

Human CAV1 Recombinant Protein

New product

378,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human CAV1 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human CAV1 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3038-100
Protein delivered with tag?: Yes
Size: 100 ug
Product name: Human CAV1 Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 12.71 kDa
Purity estimated: 0.95
Ncbi reference: Q03135
Uniprot id: Q03135
Uniprot link: http://www.uniprot.org/uniprot/Q03135
Aliases / synonyms: VIP21, Caveolae Protein 22kDa, Caveolin 1, CAV1
Protein sequence (w/o tag): SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLS
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human CD81 Recombinant Protein
- Human CD9 Recombinant Protein
- Human EGF Recombinant Protein

Buy Human CAV1 Recombinant Protein now

Add to cart