Human BST2 Recombinant Protein View larger

Human BST2 Recombinant Protein

New product

135,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human BST2 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human BST2 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3037-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human BST2 Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 39.49 kDa
Purity estimated: 0.8
Ncbi reference: Q10589
Uniprot id: Q10589
Uniprot link: http://www.uniprot.org/uniprot/Q10589
Aliases / synonyms: CD317, Tetherin, HM1.24 antigen,Bone Marrow Stromal Cell Antigen 2, BST2
Protein sequence (w/o tag): SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human CAV1 Recombinant Protein
- Human CD81 Recombinant Protein
- Human CD9 Recombinant Protein

Buy Human BST2 Recombinant Protein now

Add to cart