Login to display prices
Login to display prices
Human ANXA5 Recombinant Protein View larger

Human ANXA5 Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human ANXA5 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human ANXA5 Recombinant Protein

Proteogenix reference: PX-P3034-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human ANXA5 Recombinant Protein
Fragment type: Full-length
Expression system: Prokaryotic expression
Molecular weight with tag if any: 36.74 kDa
Purity estimated: 0.95
Ncbi reference: P08758
Uniprot id: P08758
Uniprot link: http://www.uniprot.org/uniprot/P08758
Aliases / synonyms: ANX5, ENX2, PP4, PAP-I, CBP-I, Anchorin CII, Calphobindin I, Endonexin II, Lipocortin V, Placental anticoagulant protein 4, Thromboplastin inhibitor, Vascular anticoagulant-alpha
Protein sequence (w/o tag): MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25

30 other products in the same category: