Human ANXA5 Recombinant Protein View larger

Human ANXA5 Recombinant Protein

New product

135,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human ANXA5 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human ANXA5 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3034-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human ANXA5 Recombinant Protein
Fragment type: Full-length
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 36.74 kDa
Purity estimated: 0.95
Ncbi reference: P08758
Uniprot id: P08758
Uniprot link: http://www.uniprot.org/uniprot/P08758
Aliases / synonyms: ANX5, ENX2, PP4, PAP-I, CBP-I, Anchorin CII, Calphobindin I, Endonexin II, Lipocortin V, Placental anticoagulant protein 4, Thromboplastin inhibitor, Vascular anticoagulant-alpha
Protein sequence (w/o tag): MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human BIRC5 Recombinant Protein
- Human BST2 Recombinant Protein
- Human CAV1 Recombinant Protein

Buy Human ANXA5 Recombinant Protein now

Add to cart