Human AHSG Recombinant Protein View larger

Human AHSG Recombinant Protein

New product

135,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human AHSG Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human AHSG Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3033-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human AHSG Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 38.16 kDa
Purity estimated: 0.95
Ncbi reference: P02765
Uniprot id: P02765
Uniprot link: http://www.uniprot.org/uniprot/P02765
Aliases / synonyms: HSGa, A2HS, AHS, FETUA, HSG-A2, Fetuin-A, Alpha 2-HS Glycoprotein, Fetuin A, Alpha-2-Z-Globulin, Ba-alpha-2-Glycoprotein
Protein sequence (w/o tag): APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human ANXA5 Recombinant Protein
- Human BIRC5 Recombinant Protein
- Human BST2 Recombinant Protein

Buy Human AHSG Recombinant Protein now

Add to cart