Login to display prices
Login to display prices
Human FGF14 Recombinant Protein View larger

Human FGF14 Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human FGF14 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human FGF14 Recombinant Protein

Proteogenix reference: PX-P3031-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human FGF14 Recombinant Protein
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 29.73 kDa
Purity estimated: 0.7
Ncbi reference: Q92915
Uniprot id: Q92915
Uniprot link: http://www.uniprot.org/uniprot/ Q92915
Aliases / synonyms: FHF4, SCA27, Fibroblast growth factor homologous factor 4,Active Fibroblast Growth Factor 14
Protein sequence (w/o tag): MAMVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTTLEHHHHHH
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25

30 other products in the same category: