Human FGF14 Recombinant Protein View larger

Human FGF14 Recombinant Protein

New product

135,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human FGF14 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human FGF14 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3031-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human FGF14 Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 29.73 kDa
Purity estimated: 0.7
Ncbi reference: Q92915
Uniprot id: Q92915
Uniprot link: http://www.uniprot.org/uniprot/ Q92915
Aliases / synonyms: FHF4, SCA27, Fibroblast growth factor homologous factor 4,Active Fibroblast Growth Factor 14
Protein sequence (w/o tag): MAMVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTTLEHHHHHH
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human IL22 Recombinant Protein
- Human AHSG Recombinant Protein
- Human ANXA5 Recombinant Protein

Buy Human FGF14 Recombinant Protein now

Add to cart