Human PDGFB Recombinant Protein View larger

Human PDGFB Recombinant Protein

New product

135,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human PDGFB Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human PDGFB Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3029-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human PDGFB Recombinant Protein
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 26.26 kDa
Purity estimated: 0.95
Ncbi reference: P01127
Uniprot id: P01127
Uniprot link: http://www.uniprot.org/uniprot/ P01127
Aliases / synonyms: PDGF-B, PDGF2, SIS, SSV, C-sis, Simian Sarcoma Viral(v-sis)Oncogene Homolog, Platelet Derived Growth Factor Beta Polypeptide, Proto-oncogene c-Sis, Becaplermin, Platelet Derived Growth Factor Subunit B,PDGFB
Protein sequence (w/o tag): MEEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGALEHHHHHH
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human TNFSF10 Recombinant Protein
- Human FGF14 Recombinant Protein
- Human IL22 Recombinant Protein

Buy Human PDGFB Recombinant Protein now

Add to cart