Login to display prices
Login to display prices
Human PDGFB Recombinant Protein View larger

Human PDGFB Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human PDGFB Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human PDGFB Recombinant Protein

Proteogenix reference: PX-P3029-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human PDGFB Recombinant Protein
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 26.26 kDa
Purity estimated: 0.95
Ncbi reference: P01127
Uniprot id: P01127
Uniprot link: http://www.uniprot.org/uniprot/ P01127
Aliases / synonyms: PDGF-B, PDGF2, SIS, SSV, C-sis, Simian Sarcoma Viral(v-sis)Oncogene Homolog, Platelet Derived Growth Factor Beta Polypeptide, Proto-oncogene c-Sis, Becaplermin, Platelet Derived Growth Factor Subunit B,PDGFB
Protein sequence (w/o tag): MEEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGALEHHHHHH
Form: Frozen
Buffer: PBS,pH 7.5 urea +8M
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25

30 other products in the same category: