Login to display prices
Login to display prices
Human FGF1 Recombinant Protein View larger

Human FGF1 Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human FGF1 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human FGF1 Recombinant Protein

Proteogenix reference: PX-P3028-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human FGF1 Recombinant Protein
Fragment type: Full-length
Expression system: Prokaryotic expression
Molecular weight with tag if any: 18.78 kDa
Purity estimated: 0.85
Ncbi reference: P05230
Uniprot id: P05230
Uniprot link: http://www.uniprot.org/uniprot/P05230
Aliases / synonyms: ECGF, AFGF, ECGFA, ECGFB, FGF-Alpha, FGFA, HBGF1, ECGFB, HBGF1, Acidic Fibroblast Growth Factor, heparin-binding growth factor 1, Endothelial Cell Growth Factor, Beta
Protein sequence (w/o tag): MEMAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSDLEHHHHHH
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25

30 other products in the same category: