Human FGF1 Recombinant Protein View larger

Human FGF1 Recombinant Protein

New product

135,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human FGF1 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human FGF1 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3028-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human FGF1 Recombinant Protein
Fragment type: Full-length
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 18.78 kDa
Purity estimated: 0.85
Ncbi reference: P05230
Uniprot id: P05230
Uniprot link: http://www.uniprot.org/uniprot/P05230
Aliases / synonyms: ECGF, AFGF, ECGFA, ECGFB, FGF-Alpha, FGFA, HBGF1, ECGFB, HBGF1, Acidic Fibroblast Growth Factor, heparin-binding growth factor 1, Endothelial Cell Growth Factor, Beta
Protein sequence (w/o tag): MEMAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSDLEHHHHHH
Form: Frozen
Buffer: PBS,pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human PDGFB Recombinant Protein
- Human TNFSF10 Recombinant Protein
- Human FGF14 Recombinant Protein

Buy Human FGF1 Recombinant Protein now

Add to cart