Login to display prices
Login to display prices
Rabies virus Nucleoprotein Recombinant Protein View larger

Rabies virus Nucleoprotein Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Rabies virus Nucleoprotein Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesRabies virus
Host speciesInsect

More info about Rabies virus Nucleoprotein Recombinant Protein

Proteogenix reference: PX-P3020-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Rabies virus Nucleoprotein Recombinant Protein
Fragment type: Full-length
Expression system: Eukaryotic expression
Molecular weight with tag if any: 51.58 kDa
Purity estimated: 0.85
Ncbi reference: Q0PNB8
Uniprot id: Q0PNB8
Uniprot link: http://www.uniprot.org/uniprot/Q0PNB8
Aliases / synonyms: Nucleoprotein
Protein sequence (w/o tag): MDADKIVFRVNNQVVSLKPEIIVDQYEYKYPAIKDLKKPSITLGKAPDLNKAYKSVLSGMNAAKLDPDDVCSYLAAAMQFFEGTCPEDWNSYGILIARKGDKITPDSLVDIKRTDVEGNWALTGGMELTRDPTVSEHASLVGLLLSLYRLSKISGQNTGNYKTNIADRIEQIFETAPFVKIVEHHTLMTTHKMCANWSTIPNFRFLAGTYDMFFSRIEHLYSAIRVGTVVTAYEDCSGLVSFTGFIKQINLTAKEAILYFFHKNFEEEIRRMFEPGQETAVPHSYFIHFRSLGLSGKSPYSSNAVGHVFNLIHFVGCYMGQVRSLNATVIAACAPHEMSVLGGYLGEEFFGKGTFERRFFRDEKELQEYEAAELTKTDLALADDGTVNSDDEDYFSGETRSPEAVYTRIMMNGGRLKRSHIRRYVSVSSNHQARPNSFAEFLNKTYSSDSGSHHHHHH
Form: Frozen
Buffer: Tris-HC 50mMl, NaCl 150mM, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7

30 other products in the same category: