Rabies virus Nucleoprotein Recombinant Protein View larger

Rabies virus Nucleoprotein Recombinant Protein

New product

135,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Rabies virus Nucleoprotein Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesRabies virus
Host speciesInsect

More info about Rabies virus Nucleoprotein Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3020-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Rabies virus Nucleoprotein Recombinant Protein
Fragment type: Full-length
Origin species: Rabies virus
Expression system: Eukaryotic expression
Host species: Insect
Molecular weight with tag if any: 51.58 kDa
Purity estimated: 0.85
Ncbi reference: Q0PNB8
Uniprot id: Q0PNB8
Uniprot link: http://www.uniprot.org/uniprot/Q0PNB8
Aliases / synonyms: Nucleoprotein
Protein sequence (w/o tag): MDADKIVFRVNNQVVSLKPEIIVDQYEYKYPAIKDLKKPSITLGKAPDLNKAYKSVLSGMNAAKLDPDDVCSYLAAAMQFFEGTCPEDWNSYGILIARKGDKITPDSLVDIKRTDVEGNWALTGGMELTRDPTVSEHASLVGLLLSLYRLSKISGQNTGNYKTNIADRIEQIFETAPFVKIVEHHTLMTTHKMCANWSTIPNFRFLAGTYDMFFSRIEHLYSAIRVGTVVTAYEDCSGLVSFTGFIKQINLTAKEAILYFFHKNFEEEIRRMFEPGQETAVPHSYFIHFRSLGLSGKSPYSSNAVGHVFNLIHFVGCYMGQVRSLNATVIAACAPHEMSVLGGYLGEEFFGKGTFERRFFRDEKELQEYEAAELTKTDLALADDGTVNSDDEDYFSGETRSPEAVYTRIMMNGGRLKRSHIRRYVSVSSNHQARPNSFAEFLNKTYSSDSGSHHHHHH
Form: Frozen
Buffer: Tris-HC 50mMl, NaCl 150mM, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Related products: - Human NMNAT2 Recombinant Protein
- Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein-10 ug
- Human Thyroid peroxidase(TPO) Recombinant Protein

Buy Rabies virus Nucleoprotein Recombinant Protein now

Add to cart