Login to display prices
Login to display prices
Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein View larger

Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesDermatophagoides farinae (American house dust mite)
Host speciesInsect

More info about Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein

Proteogenix reference: PX-P3018-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein
Fragment type: Full-length
Expression system: Eukaryotic expression
Molecular weight with tag if any: 51.58 kDa
Purity estimated: 0.9
Ncbi reference: A1YW12
Uniprot id: A1YW12
Uniprot link: http://www.uniprot.org/uniprot/A1YW12
Aliases / synonyms: Der f 1 allergen(Derf1)
Protein sequence (w/o tag): MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQKLVDCASQHGCHGDTIPRGIE YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLM MIEQYPYVVIMGSHHHHHH
Form: Frozen
Buffer: PBS, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25

30 other products in the same category: