View larger

Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein

New product

135,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesChinese sturgeon
Host speciesMammalian

More info about Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3017-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein
Fragment type: Full-length
Origin species: Chinese sturgeon
Expression system: Eukaryotic expression
Host species: Mammalian
Molecular weight with tag if any: 40.94 kDa
Purity estimated: 0.9
Ncbi reference: B2CKR4
Uniprot id: B2CKR4
Uniprot link: http://www.uniprot.org/uniprot/B2CKR4
Aliases / synonyms: ICSH, Lutropin, Interstitial Cell Stimulating Hormone
Protein sequence (w/o tag): MPASMPLLLLLFSALILSHSSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNYDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Form: Frozen
Buffer: PBS, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Related products: - Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein
- Caenorhabditis elegans HECtD1 Recombinant Protein
- Rabies virus Nucleoprotein Recombinant Protein
Image: PX-P3017.jpg

Buy Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein now

Add to cart