Login to display prices
Login to display prices
Human Tryptase alpha/beta-1(TPSAB1) Recombinant Protein View larger

Human Tryptase alpha/beta-1(TPSAB1) Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human Tryptase alpha/beta-1(TPSAB1) Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesMammalian

More info about Human Tryptase alpha/beta-1(TPSAB1) Recombinant Protein

Proteogenix reference: PX-P3015-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human Tryptase alpha/beta-1(TPSAB1) Recombinant Protein
Fragment type: Full-length
Expression system: Eukaryotic expression
Molecular weight with tag if any: 31.23 kDa
Purity estimated: 0.9
Ncbi reference: Q15661
Uniprot id: Q15661
Uniprot link: http://www.uniprot.org/uniprot/Q15661
Aliases / synonyms: TPSAB1, Tryptase Alpha/Beta 1, Tryptase Alpha II, Tryptase Beta I, Tryptase-I, Tryptase-II, Tryptase-III,Tryptase, TPS
Protein sequence (w/o tag): MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPGSHHHHHH
Form: Frozen
Buffer: NaCl 150mM, Tris-HCl 50 mM, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Image: PX-P3015.jpg

30 other products in the same category: