Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
View larger 
Data sheet of Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Dog |
| Host species | Mammalian |
More info about Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein
| Proteogenix reference: | PX-P3014-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein |
| Fragment type: | Partial |
| Expression system: | Eukaryotic expression |
| Molecular weight with tag if any: | 25.94 kDa |
| Purity estimated: | 0.9 |
| Ncbi reference: | E2RKZ5 |
| Uniprot id: | E2RKZ5 |
| Uniprot link: | http://www.uniprot.org/uniprot/E2RKZ5 |
| Aliases / synonyms: | CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1 |
| Protein sequence (w/o tag): | MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH |
| Form: | Frozen |
| Buffer: | PBS, pH 7.5 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Biological activity: | Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml. |
| Delivery lead time in business days: | 2-3 |
| Description: | Programmed death-ligand 1 (PD-L1) also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) and programmed cell death 1 ligand 1 (PDCD1L1) is a part of the growing B7 family of immune proteins that provide signals for both stimulating and inhibiting T cell activation. It play a main role in suppressing the immune system during some events such as tissue allografts, pregnancy, autoimmune disorder and other disease states such as hepatitis. |
| Publications: | 1: Shosu K, Sakurai M, Inoue K, Nakagawa T, Sakai H, Morimoto M, Okuda M, Noguchi S, Mizuno T. Programmed Cell Death Ligand 1 Expression in Canine Cancer. In Vivo. 2016 May-Jun;30(3):195-204. PubMed PMID: 27107075. |