Login to display prices
Login to display prices
Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein View larger

Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesDog
Host speciesMammalian

More info about Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein

Proteogenix reference: PX-P3014-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein
Fragment type: Partial
Expression system: Eukaryotic expression
Molecular weight with tag if any: 25.94 kDa
Purity estimated: 0.9
Ncbi reference: E2RKZ5
Uniprot id: E2RKZ5
Uniprot link: http://www.uniprot.org/uniprot/E2RKZ5
Aliases / synonyms: CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1
Protein sequence (w/o tag): MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH
Form: Frozen
Buffer: PBS, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Biological activity: Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml.
Delivery lead time in business days: 2-3
Description: Programmed death-ligand 1 (PD-L1) also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) and programmed cell death 1 ligand 1 (PDCD1L1) is a part of the growing B7 family of immune proteins that provide signals for both stimulating and inhibiting T cell activation. It play a main role in suppressing the immune system during some events such as tissue allografts, pregnancy, autoimmune disorder and other disease states such as hepatitis.
Publications: 1: Shosu K, Sakurai M, Inoue K, Nakagawa T, Sakai H, Morimoto M, Okuda M, Noguchi S, Mizuno T. Programmed Cell Death Ligand 1 Expression in Canine Cancer. In Vivo. 2016 May-Jun;30(3):195-204. PubMed PMID: 27107075.

30 other products in the same category: