New product
Availability date:
Brand | ProteoGenix |
Product type | Proteins |
Origin species | Dog |
Host species | Mammalian |
Brand: | ProteoGenix |
Proteogenix reference: | PX-P3014-10 |
Protein delivered with tag?: | Yes |
Size: | 10 ug |
Product name: | Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein |
Fragment type: | Partial |
Origin species: | Dog |
Expression system: | Eukaryotic expression |
Host species: | Mammalian |
Molecular weight with tag if any: | 25.94 kDa |
Purity estimated: | 0.9 |
Ncbi reference: | E2RKZ5 |
Uniprot id: | E2RKZ5 |
Uniprot link: | http://www.uniprot.org/uniprot/E2RKZ5 |
Aliases / synonyms: | CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1 |
Protein sequence (w/o tag): | MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH |
Form: | Frozen |
Buffer: | PBS, pH 7.5 |
Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Delivery condition: | Dry Ice |
Biological activity: | Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml. |
Delivery lead time in business days: | 2-3 |
Related products: | - Human Tryptase alpha/beta-1(TPSAB1) Recombinant Protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein - Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein |
Description: | Programmed death-ligand 1 (PD-L1) also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) and programmed cell death 1 ligand 1 (PDCD1L1) is a part of the growing B7 family of immune proteins that provide signals for both stimulating and inhibiting T cell activation. It play a main role in suppressing the immune system during some events such as tissue allografts, pregnancy, autoimmune disorder and other disease states such as hepatitis. |
Publications: | 1: Shosu K, Sakurai M, Inoue K, Nakagawa T, Sakai H, Morimoto M, Okuda M, Noguchi S, Mizuno T. Programmed Cell Death Ligand 1 Expression in Canine Cancer. In Vivo. 2016 May-Jun;30(3):195-204. PubMed PMID: 27107075. |