Brand | ProteoGenix |
Product type | Proteins |
Origin species | Human |
Host species | Mammalian |
Brand: | ProteoGenix |
Proteogenix reference: | PX-P3013-10 |
Protein delivered with tag?: | Yes |
Size: | 10 ug |
Product name: | Human IL6 Recombinant Protein |
Fragment type: | Full-length |
Origin species: | Human |
Expression system: | Eukaryotic expression |
Host species: | Mammalian |
Molecular weight with tag if any: | 49.8 kDa |
Purity estimated: | 0.95 |
Ncbi reference: | P05231 |
Uniprot id: | P05231 |
Uniprot link: | http://www.uniprot.org/uniprot/P05231 |
Aliases / synonyms: | Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma growth factor,Interferon beta-2,IFN-beta-2,BSF-2 |
Protein sequence (w/o tag): | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
Form: | Frozen |
Buffer: | PBS, pH 7.5 |
Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Delivery condition: | Dry Ice |
Delivery lead time in business days: | 5-7 |
Related products: | - Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein - Human Tryptase alpha/beta-1(TPSAB1) Recombinant Protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein |
Image: | ![]() |
Description: | Recombinant Human Interleukin 6 (IL6) is a multifunctional protein initially discovered in the media of cells stimulated with double stranded DNA. It is a pleiotropic cytokine that plays an important role in multiple cellular processes including inflammation, immune response and hematopoiesis. IL-6 is produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes and has diversified biological functions. It provokes B cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, promotes expression of hepatic acute-phase proteins, and readjust bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. |
Publications: | 1: Breton J, La Fiura A, Bertolero F, Orsini G, Valsasina B, Ziliotto R, De Filippis V, Polverino de Laureto P, Fontana A. Structure, stability and biological properties of a N-terminally truncated form of recombinant human interleukin-6 containing a single disulfide bond. Eur J Biochem. 1995 Jan 15;227(1-2):573-81. PubMed PMID: 7851440. |