Login to display prices
Login to display prices
Human IL6 Recombinant Protein View larger

Human IL6 Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human IL6 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesMammalian

More info about Human IL6 Recombinant Protein

Proteogenix reference: PX-P3013-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human IL6 Recombinant Protein
Fragment type: Full-length
Expression system: Eukaryotic expression
Molecular weight with tag if any: 49.8 kDa
Purity estimated: 0.95
Ncbi reference: P05231
Uniprot id: P05231
Uniprot link: http://www.uniprot.org/uniprot/P05231
Aliases / synonyms: Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma growth factor,Interferon beta-2,IFN-beta-2,BSF-2
Protein sequence (w/o tag): MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Form: Frozen
Buffer: PBS, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Image: PX-P3013.jpg
Description: Recombinant Human Interleukin 6 (IL6) is a multifunctional protein initially discovered in the media of cells stimulated with double stranded DNA. It is a pleiotropic cytokine that plays an important role in multiple cellular processes including inflammation, immune response and hematopoiesis. IL-6 is produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes and has diversified biological functions. It provokes B cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, promotes expression of hepatic acute-phase proteins, and readjust bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130.
Publications: 1: Breton J, La Fiura A, Bertolero F, Orsini G, Valsasina B, Ziliotto R, De Filippis V, Polverino de Laureto P, Fontana A. Structure, stability and biological properties of a N-terminally truncated form of recombinant human interleukin-6 containing a single disulfide bond. Eur J Biochem. 1995 Jan 15;227(1-2):573-81. PubMed PMID: 7851440.

30 other products in the same category: