Human Resistin-like alpha (HIMF) Recombinant Protein View larger

Human Resistin-like alpha (HIMF) Recombinant Protein

New product

135,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human Resistin-like alpha (HIMF) Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesMammalian

More info about Human Resistin-like alpha (HIMF) Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P3011-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human Resistin-like alpha (HIMF) Recombinant Protein
Fragment type: Full-length
Origin species: Human
Expression system: Eukaryotic expression
Host species: Mammalian
Molecular weight with tag if any: 36 kDa
Purity estimated: 0.85
Ncbi reference: Q9BQ08
Uniprot id: Q9BQ08
Uniprot link: http://www.uniprot.org/uniprot/Q9BQ08
Aliases / synonyms: Resistin-like beta, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, RELMbeta
Protein sequence (w/o tag): MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLSLEVLFQGPDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Form: Frozen
Buffer: Tris-HCl 0.1M, Glycine 0.1M, pH8.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human 10 kDa heat shock protein, mitochondrial(HSPE1) Recombinant Protein
- Human IL6 Recombinant Protein
- Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein

Buy Human Resistin-like alpha (HIMF) Recombinant Protein now

Add to cart