Login to display prices
Login to display prices
Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein View larger

Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesMammalian

More info about Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein

Proteogenix reference: PX-P3010-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein
Fragment type: Full-length
Expression system: Eukaryotic expression
Molecular weight with tag if any: 13.96 kDa
Purity estimated: 0.95
Ncbi reference: Q14508
Uniprot id: Q14508
Uniprot link: http://www.uniprot.org/uniprot/Q14508
Aliases / synonyms: WFDC2, HE4, WAP5, EDDM4, Epididymal Protein 4, Epididymal Secretory Protein E4, Putative Protease Inhibitor WAP5, Major epididymis-specific protein E4
Protein sequence (w/o tag): MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFGSHHHHHH
Form: Frozen
Buffer: PBS, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Image: PX-P3010.jpg

30 other products in the same category: