Login to display prices
Login to display prices
Human Beta-2-microglobulin(B2M) Recombinant Protein View larger

Human Beta-2-microglobulin(B2M) Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human Beta-2-microglobulin(B2M) Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesMammalian

More info about Human Beta-2-microglobulin(B2M) Recombinant Protein

Proteogenix reference: PX-P3007-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human Beta-2-microglobulin(B2M) Recombinant Protein
Fragment type: Full-length
Expression system: Eukaryotic expression
Molecular weight with tag if any: 14.5 kDa
Purity estimated: 0.9
Ncbi reference: P61769
Uniprot id: P61769
Uniprot link: http://www.uniprot.org/uniprot/P61769
Aliases / synonyms: BMG, B2MG, Beta-2-Microglobulin, b2M
Protein sequence (w/o tag): MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMHHHHHH
Form: Frozen
Buffer: PBS, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7
Image: PX-P3007.jpg

30 other products in the same category: