Login to display prices
Login to display prices
Human Gastrin-releasing peptide(PROGRP) Recombinant Protein View larger

Human Gastrin-releasing peptide(PROGRP) Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human Gastrin-releasing peptide(PROGRP) Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human Gastrin-releasing peptide(PROGRP) Recombinant Protein

Proteogenix reference: PX-P3006-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human Gastrin-releasing peptide(PROGRP) Recombinant Protein
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 34.58 kDa
Purity estimated: 0.4
Ncbi reference: H0Y5C5
Uniprot id: H0Y5C5
Uniprot link: http://www.uniprot.org/uniprot/H0Y5C5
Aliases / synonyms: pro-GRP, preproGRP, pre-proGRP,Pro-Gastrin Releasing Peptide, ProGRP
Protein sequence (w/o tag): LEVLFQGPSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKD
Form: Frozen
Buffer: PBS, pH 7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25

30 other products in the same category: