Login to display prices
Login to display prices
Human Serum amyloid A-1 protein(SAA1) Recombinant Protein View larger

Human Serum amyloid A-1 protein(SAA1) Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human Serum amyloid A-1 protein(SAA1) Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human Serum amyloid A-1 protein(SAA1) Recombinant Protein

Proteogenix reference: PX-P3003-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human Serum amyloid A-1 protein(SAA1) Recombinant Protein
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 13.2 kDa
Purity estimated: 0.9
Spec:ncbi gene aliases: SAA1
Ncbi reference: P0DJI8
Uniprot id: P0DJI8
Uniprot link: http://www.uniprot.org/uniprot/P0DJI8
Aliases / synonyms: Serum amyloid A-1 protein, SAA, Amyloid fibril protein AA
Protein sequence (w/o tag): MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Form: Frozen
Buffer: Tris-HC 50mMl, NaCl 150mM, pH7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 5-7

30 other products in the same category: