Login to display prices
Login to display prices
Streptococcus 6His-Protein G View larger

Streptococcus 6His-Protein G

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Streptococcus 6His-Protein G

BrandProteoGenix
Product typeProteins
Origin speciesStreptococcus
Host speciesEscherichia coli (E. coli)

More info about Streptococcus 6His-Protein G

Proteogenix reference: PX-P2102-10mg
Protein delivered with tag?: Yes
Size: 10 mg
Product name: Streptococcus 6His-Protein G
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 20.96 KDa
Purity estimated: 0.9
Spec:swissprotid: P19909
Ncbi reference: CAA37410.1
Aliases / synonyms: 6His-Protein G
Protein sequence (w/o tag): MGKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEHHHHHH
Form: Frozen
Buffer: PBS,pH7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25

30 other products in the same category: