Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Staphylococcus 6His-Protein A
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Staphylococcus |
| Host species | Escherichia coli (E. coli) |
More info about Staphylococcus 6His-Protein A
| Proteogenix reference: | PX-P2101-10mg |
| Protein delivered with tag?: | Yes |
| Size: | 10 mg |
| Product name: | Staphylococcus 6His-Protein A |
| Fragment type: | Partial |
| Expression system: | Prokaryotic expression |
| Molecular weight with tag if any: | 33.83 KDa |
| Purity estimated: | 0.9 |
| Spec:swissprotid: | P38507 |
| Ncbi reference: | EYF82342.1 |
| Uniprot id: | P38507 |
| Uniprot link: | http://www.uniprot.org/uniprot/P38507 |
| Aliases / synonyms: | 6His-Protein A |
| Protein sequence (w/o tag): | MGAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLP |
| Form: | Frozen |
| Buffer: | PBS,pH7.5 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |