Login to display prices
Login to display prices
Staphylococcus 6His-Protein A View larger

Staphylococcus 6His-Protein A

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Staphylococcus 6His-Protein A

BrandProteoGenix
Product typeProteins
Origin speciesStaphylococcus
Host speciesEscherichia coli (E. coli)

More info about Staphylococcus 6His-Protein A

Proteogenix reference: PX-P2101-10mg
Protein delivered with tag?: Yes
Size: 10 mg
Product name: Staphylococcus 6His-Protein A
Fragment type: Partial
Expression system: Prokaryotic expression
Molecular weight with tag if any: 33.83 KDa
Purity estimated: 0.9
Spec:swissprotid: P38507
Ncbi reference: EYF82342.1
Uniprot id: P38507
Uniprot link: http://www.uniprot.org/uniprot/P38507
Aliases / synonyms: 6His-Protein A
Protein sequence (w/o tag): MGAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLP
Form: Frozen
Buffer: PBS,pH7.5
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25

30 other products in the same category: