Brand | ProteoGenix |
Product type | Proteins |
Origin species | Staphylococcus |
Host species | Escherichia coli (E. coli) |
Brand: | ProteoGenix |
Proteogenix reference: | PX-P2101-10mg |
Protein delivered with tag?: | Yes |
Size: | 10 mg |
Product name: | Staphylococcus 6His-Protein A |
Fragment type: | Partial |
Origin species: | Staphylococcus |
Expression system: | Prokaryotic expression |
Host species: | Escherichia coli (E. coli) |
Molecular weight with tag if any: | 33.83 KDa |
Purity estimated: | 0.9 |
Spec:swissprotid: | P38507 |
Ncbi reference: | EYF82342.1 |
Uniprot id: | P38507 |
Uniprot link: | http://www.uniprot.org/uniprot/P38507 |
Aliases / synonyms: | 6His-Protein A |
Protein sequence (w/o tag): | MGAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLP |
Form: | Frozen |
Buffer: | PBS,pH7.5 |
Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Delivery condition: | Dry Ice |
Delivery lead time in business days: | 10-25 |
Related products: | - Streptococcus 6His-Protein G - Human Pepsin A-3(PGI) Recombinant Protein - Human Gastricsin(PGII)/PGC Recombinant Protein |